PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_2BL_A5BFA97B9.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family WRKY
Protein Properties Length: 229aa    MW: 25063.3 Da    PI: 8.5575
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_2BL_A5BFA97B9.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.93.6e-32151209159
                            ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                   WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                            ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+H+h+
  Traes_2BL_A5BFA97B9.1 151 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHTHT 209
                            59********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.801.2E-33136209IPR003657WRKY domain
SuperFamilySSF1182901.57E-28143209IPR003657WRKY domain
PROSITE profilePS5081128.908146208IPR003657WRKY domain
SMARTSM007741.4E-37151210IPR003657WRKY domain
PfamPF031063.9E-25152208IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 229 aa     Download sequence    Send to blast
MEGGSQLGAC LPSLYALDPY ASPPLLAPSP NQHKLHQLPP VLQEQPGVHG VMFSSDHGGG  60
LYPLLPGIPF CHSAAACEKH TGFAPLGSTG EAGTLAARQG NEIASATTTT TASCHGPSSW  120
WKGAEKGKMK VRRKMREPRF CFQTRSEVDV LDDGYKWRKY GQKVVKNSLH PRSYYRCTHS  180
NCRVKKRVER LSEDCRMVIT TYEGRHTHTP CSDDDVGGDH TGSCAFTSF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A4e-25142208874Probable WRKY transcription factor 4
2lex_A4e-25142208874Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU6654320.0EU665432.1 Triticum aestivum WRKY3 transcription factor mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_014751531.11e-119PREDICTED: probable WRKY transcription factor 12
SwissprotQ93WY42e-59WRK12_ARATH; Probable WRKY transcription factor 12
TrEMBLW5BDK81e-173W5BDK8_WHEAT; Uncharacterized protein
STRINGMLOC_66345.11e-115(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP113838130
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G44745.11e-59WRKY family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]